Protein Info for ABIE51_RS16295 in Lysobacter sp. OAE881

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02937: RNA polymerase sigma factor, sigma-70 family
  • amino acids 38 to 196 (159 residues), 105 bits, E=1.6e-34
• PF04542: Sigma70_r2
  • amino acids 42 to 110 (69 residues), 67.4 bits, E=1.1e-22
• PF08281: Sigma70_r4_2
  • amino acids 140 to 190 (51 residues), 62.5 bits, E=3.5e-21
• PF04545: Sigma70_r4
  • amino acids 145 to 193 (49 residues), 32 bits, E=1.1e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 58% identity to xcb:XC_2934)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Protein Sequence (200 amino acids)

>ABIE51_RS16295 sigma-70 family RNA polymerase sigma factor (Lysobacter sp. OAE881)
MDMLTVVTESLTDAPAVPDDGSEERSLVSAAARGEMRAFEALYRRHAGRVHGVIARLVGG
HGARAEDLTQEAFVRAWQALPAFRFESAFSTWLHRLAVNTALMELRSRRSRPQDEGDSDE
EVFDLIGSADSAGHTTALSMDLERAVASLPPRARAVLVLYDVEGWKHEEIAAELGMAVGS
SKAQLHRARNLLRDRLEAHA