Protein Info for ABIE51_RS16185 in Lysobacter sp. OAE881
Annotation: O-succinylhomoserine (thiol)-lyase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to METB_ECOLI: Cystathionine gamma-synthase (metB) from Escherichia coli (strain K12)
KEGG orthology group: K01739, cystathionine gamma-synthase [EC: 2.5.1.48] (inferred from 79% identity to smt:Smal_3050)MetaCyc: 56% identical to O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase (Escherichia coli K-12 substr. MG1655)
4.3.1.-; Cystathionine gamma-synthase. [EC: 2.5.1.48]
Predicted SEED Role
"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)
MetaCyc Pathways
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
- aspartate superpathway (19/25 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
- homocysteine and cysteine interconversion (3/4 steps found)
- L-methionine biosynthesis II (4/6 steps found)
- superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
- superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
- L-methionine biosynthesis I (2/5 steps found)
KEGG Metabolic Maps
- Biosynthesis of plant hormones
- Cysteine metabolism
- Methionine metabolism
- Selenoamino acid metabolism
- Sulfur metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.5.1.48
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (397 amino acids)
>ABIE51_RS16185 O-succinylhomoserine (thiol)-lyase (Lysobacter sp. OAE881) MSTTRNRCTAAVRAGIDRDTAFGAVTPPLVLSSNFSFAGFNEKRQYDYTRSGNPTRDLLG EALAELEGGAGGVVTATGMGAITLLLHALLKPGDRLVVPHDGYGGSWRLFNALAKKGAFE LITADLTDPRALTDALASDPTVVWIETPSNPLLRITDLRFVIEAAKAKGAVTVVDNTFLS PALQQPIAFGADYVVHSTTKYINGHSDVVGGAVVARETEAHQQLVWWANALGLTGSPFDA FLTLRGLRTLDARLRAHQENTHALVSLLDAHPAVRVVHYPGLESHPGHAIAARQQEGFGA MLSVELDGGVDAVRAFLDGLQCFTLAESLGGVESLVAHPATMTHAAMSPEAREAAGIGDG LLRVSVGIEHVDDLVADIAAALERAEQAVAVAERIKG