Protein Info for ABIE51_RS16185 in Lysobacter sp. OAE881

Annotation: O-succinylhomoserine (thiol)-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02080: O-succinylhomoserine (thiol)-lyase
  • amino acids 5 to 383 (379 residues), 589.5 bits, E=1.2e-181
• PF01053: Cys_Met_Meta_PP
  • amino acids 9 to 383 (375 residues), 449.8 bits, E=3e-139

Best Hits

Swiss-Prot: 56% identical to METB_ECOLI: Cystathionine gamma-synthase (metB) from Escherichia coli (strain K12)

KEGG orthology group: K01739, cystathionine gamma-synthase [EC: 2.5.1.48] (inferred from 79% identity to smt:Smal_3050)

MetaCyc: 56% identical to O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase (Escherichia coli K-12 substr. MG1655)
4.3.1.-; Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• aspartate superpathway (19/25 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
• L-methionine biosynthesis I (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.48

Protein Sequence (397 amino acids)

>ABIE51_RS16185 O-succinylhomoserine (thiol)-lyase (Lysobacter sp. OAE881)
MSTTRNRCTAAVRAGIDRDTAFGAVTPPLVLSSNFSFAGFNEKRQYDYTRSGNPTRDLLG
EALAELEGGAGGVVTATGMGAITLLLHALLKPGDRLVVPHDGYGGSWRLFNALAKKGAFE
LITADLTDPRALTDALASDPTVVWIETPSNPLLRITDLRFVIEAAKAKGAVTVVDNTFLS
PALQQPIAFGADYVVHSTTKYINGHSDVVGGAVVARETEAHQQLVWWANALGLTGSPFDA
FLTLRGLRTLDARLRAHQENTHALVSLLDAHPAVRVVHYPGLESHPGHAIAARQQEGFGA
MLSVELDGGVDAVRAFLDGLQCFTLAESLGGVESLVAHPATMTHAAMSPEAREAAGIGDG
LLRVSVGIEHVDDLVADIAAALERAEQAVAVAERIKG