Protein Info for ABIE51_RS16175 in Lysobacter sp. OAE881

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF06342: DUF1057" amino acids 51 to 175 (125 residues), 26.1 bits, see alignment E=1.1e-09 PF12146: Hydrolase_4" amino acids 67 to 271 (205 residues), 67.2 bits, see alignment E=3.5e-22 PF00561: Abhydrolase_1" amino acids 68 to 217 (150 residues), 91.7 bits, see alignment E=1.5e-29 PF12697: Abhydrolase_6" amino acids 69 to 325 (257 residues), 84.7 bits, see alignment E=3.9e-27

Best Hits

KEGG orthology group: None (inferred from 69% identity to xcv:XCV3174)

Predicted SEED Role

"2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation or carbazol degradation cluster (EC 3.7.1.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>ABIE51_RS16175 alpha/beta hydrolase (Lysobacter sp. OAE881)
MRSSLLACALSLVLSPHLALAADVPSYGMELEGFDYPFPVKHHAFTSQGEALRMAYLDVA
PITPNGRTVVLLHGKNFCAATWESAIRALTGAGYRVIAPDQIGFCKSSKPEHYQYSFQQL
ASNTNALLESLGIERASIVGHSMGGMLATRYALMYPQRTEALMLVNPIGLEDWKALGVPW
ASVDANLAGELKTNFESIKRYQQQVYYSGQWKPEYDRWVSMLAGLYAGPGKQRIAWNQAL
TTDMVFTQPVVHEFPQIRVPTTLFIGQRDRTAIGRDRASPELRERLGDYPALGKRAAKAI
PGATLVEFDDLGHSPQVEAPARFEKALLEALARTR