Protein Info for ABIE51_RS16100 in Lysobacter sp. OAE881

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01357: 3-dehydroquinate synthase
  • amino acids 15 to 363 (349 residues), 381 bits, E=2.9e-118
• PF13685: Fe-ADH_2
  • amino acids 19 to 238 (220 residues), 44.1 bits, E=2.4e-15
• PF01761: DHQ_synthase
  • amino acids 71 to 334 (264 residues), 343.6 bits, E=6.3e-107

Best Hits

Swiss-Prot: 66% identical to AROB_XANCP: 3-dehydroquinate synthase (aroB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 70% identity to psu:Psesu_0770)

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (16/18 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• chorismate biosynthesis I (6/7 steps found)
• superpathway of L-tyrosine biosynthesis (8/10 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Protein Sequence (368 amino acids)

>ABIE51_RS16100 3-dehydroquinate synthase (Lysobacter sp. OAE881)
MSTMRTVKVDGEARYDICIGPNLLGDSALLSHALRGRHALIVSDGNVAPLYADRVEATLR
AARPTLSIACFVIPPGEQEKTLARFCEALDALAKLCATRDATVIALGGGVVGDLAGFAAA
CWMRGIDVVQLPTTLLAMVDSSVGGKTAVDLPAGKNLVGAFHPPRAVIADTTTLRTLPER
ELRAGLAEVVKYGAIFDAEFLTWLEHHADALLAGDDAALSEAIARSCQYKAEVVSRDPYE
HGERALLNFGHTFGHAIEAAQGYAGAGSAALNHGEAVAVGMVLAARLSAALGLAHASDTH
RLQALLQRLGLPTVIPAGLEAEALLDRMRLDKKAEAHGLRFVLWERAGLAKIVSGVPDER
VLDVLRGR