Protein Info for ABIE51_RS15950 in Lysobacter sp. OAE881

Annotation: LPS export ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 2 to 239 (238 residues), 379.3 bits, see alignment E=3.1e-118 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 119.2 bits, see alignment E=2.2e-38 PF12399: BCA_ABC_TP_C" amino acids 213 to 237 (25 residues), 29.4 bits, see alignment (E = 4.9e-11)

Best Hits

Swiss-Prot: 60% identical to LPTB_ECOL6: Lipopolysaccharide export system ATP-binding protein LptB (lptB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 89% identity to xal:XALc_2139)

MetaCyc: 64% identical to lipopolysaccharide transport system ATP-binding protein (Brucella abortus 2308)
TRANS-RXN2B4Q-128 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>ABIE51_RS15950 LPS export ABC transporter ATP-binding protein (Lysobacter sp. OAE881)
MLVAQGLRKAYRSREVVKDFGLTLDAGEVVGLLGPNGAGKTTCFYMIVGLVPADAGQIVL
DGKDITSEPMYARAKYGVGYLPQEPSVFRKLSVADNIRLVLELREDLDRNGRDRELDSLL
DELQVGHVADQIGASLSGGERRRVEIARALAARPRLMLLDEPFAGVDPISVGEIQRIVSH
LKNRGIGVLITDHNVRETLGICDRAYILNEGGVLAQGAPDALLANPDVRRVYLGETFRL