Protein Info for ABIE51_RS15890 in Lysobacter sp. OAE881

Annotation: phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase
  • amino acids 11 to 338 (328 residues), 447.3 bits, E=1.7e-138
• PF00586: AIRS
  • amino acids 63 to 167 (105 residues), 78.9 bits, E=4e-26
• PF02769: AIRS_C
  • amino acids 180 to 339 (160 residues), 126.9 bits, E=8e-41

Best Hits

Swiss-Prot: 79% identical to PUR5_STRM5: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 85% identity to psu:Psesu_1078)

MetaCyc: 62% identical to phosphoribosylformylglycinamide cyclo-ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylformylglycinamidine cyclo-ligase. [EC: 6.3.3.1]

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Protein Sequence (352 amino acids)

>ABIE51_RS15890 phosphoribosylformylglycinamidine cyclo-ligase (Lysobacter sp. OAE881)
MSSSPSAPTPITYRDAGVDIDAGNEVVERIKPLVKRSFRPEVMGGLGGFGALFDLSGKYK
EPVLVSGTDGVGTKLKLAQQLNRHDTIGIDLVAMCVNDVLVQGAEPLFFLDYFATGKLDV
DTTVAVVGGIAKGCELSGCALIGGETAEMPDMYPPGEYDLAGFCVAAVEKSKLLDGAKVR
EGDVLIGIASSGPHSNGYSLVRRIYDRAGRPADLDVGGVKLIDALMAPTQLYVKPVLELL
GKHDLHAMAHITGGGLTENIIRVIPDGLGLDIEASAIVLPPVFEWLQREGAVPNEEMWRT
FNCGVGFVLVVAPGDVAAVNADLDRLGLRHRPMGQVVKAAAGASLESRVHIG