Protein Info for ABIE51_RS15880 in Lysobacter sp. OAE881

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 243 to 273 (31 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 310 to 347 (38 residues), see Phobius details PF01594: AI-2E_transport" amino acids 21 to 346 (326 residues), 211.8 bits, see alignment E=7.6e-67

Best Hits

KEGG orthology group: None (inferred from 63% identity to xca:xccb100_1373)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>ABIE51_RS15880 AI-2E family transporter (Lysobacter sp. OAE881)
MQSQALDDIARFLRRLQWTALALAVCWLVWVLAPILTPFVFALILAWLGDPLVDRLERAG
RSRNVAVTLVFTAMALIVLAGLLILVPLLERQIETLIASWPHYRDWFMVTALPWVEQRLG
IELTDWLDFGHLSQLVRENWDRAGGIAATVLGYLSRSGFAVIGIVANVALLPVITFFFLR
DWDLLVERVASLIPRDHLDVVSRLAHESSEVLSAFLRGQFLVMLVLGVMYGLGLWAVGLD
LGILIGLIAGLLTFVPYLGPASGILLGVIAALVQYGDWQHVAGVLVVFGIGQVIESYVLT
PKLVGDRIGLHPVAVIFAVLAGGQLFGFLGMLLALPVSAVVNVLLRYAQERYRHSRLYVG
THSLPEDAVPDPLADPHLPPPVDRKPE