Protein Info for ABIE51_RS15755 in Lysobacter sp. OAE881

Annotation: non-heme iron oxygenase ferredoxin subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13806: Rieske_2
  • amino acids 7 to 105 (99 residues), 46.4 bits, E=3.3e-16
• PF00355: Rieske
  • amino acids 7 to 96 (90 residues), 66.4 bits, E=1.7e-22

Best Hits

Swiss-Prot: 41% identical to BNZC_PSEPU: Benzene 1,2-dioxygenase system ferredoxin subunit (bnzC) from Pseudomonas putida

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 68% identity to psu:Psesu_1094)

MetaCyc: 38% identical to benzene 1,2 dioxygenase ferredoxin subunit (Pseudomonas sp. ML2)
Benzene 1,2-dioxygenase. [EC: 1.14.12.3]

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

• benzene degradation I (aerobic) (1/2 steps found)

KEGG Metabolic Maps

• Naphthalene and anthracene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.3

Protein Sequence (111 amino acids)

>ABIE51_RS15755 non-heme iron oxygenase ferredoxin subunit (Lysobacter sp. OAE881)
MSGAAEQWVFVCATSQLLPGERTVAWDGDTAILVVNYDGDYYALEDKCSHEDFELSAGNF
DGEEATIECVLHGAKFDVRDGRPLCAPAYEPVPKFPVKVDDVGVWTRDDRG