Protein Info for ABIE51_RS15680 in Lysobacter sp. OAE881

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 680 PF00009: GTP_EFTU" amino acids 7 to 260 (254 residues), 126.5 bits, see alignment E=2.5e-40 TIGR00231: small GTP-binding protein domain" amino acids 8 to 149 (142 residues), 47.7 bits, see alignment E=7.3e-17 PF01926: MMR_HSR1" amino acids 10 to 134 (125 residues), 29.8 bits, see alignment E=1.4e-10 PF14492: EFG_III" amino acids 385 to 457 (73 residues), 85.8 bits, see alignment E=4.4e-28 PF03764: EFG_IV" amino acids 460 to 578 (119 residues), 133.7 bits, see alignment E=7.6e-43 PF00679: EFG_C" amino acids 582 to 668 (87 residues), 89.8 bits, see alignment E=2.4e-29

Best Hits

KEGG orthology group: K02355, elongation factor G (inferred from 71% identity to psu:Psesu_2207)

Predicted SEED Role

"Translation elongation factor G-related protein" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (680 amino acids)

>ABIE51_RS15680 elongation factor G (Lysobacter sp. OAE881)
MSYSTQSIRNVALAGHPGAGKTTLFEALLQAGGALQTAGTIERGSTVSDFDPIEKQRGHS
IDASIASIDHAGMHVNLIDTPGYPDFRGPALSALGAVETVAVVVDAAAGVEYGTRRMMEY
ARGRNLCRAIIVNKIDHEGASLEGVLADLRETFGPECLPLNLPADGGKKVVDCLINPQGD
SDLGPVADWHQKIIDQIVEINETVMEHYLDLGEEGLSGDELHDAFEQCLREGHLVPVLFC
SARTGAGIGELLDVAERWFPNPAEANEPPYEKGPERTRIQAAPDPRAHVIADVFKIVNDP
FVGKLGVFRVHQGTVKKDTQLFVDDGKKPFKVGHLFKLRGKDHVEIEQAIPGDIAAVAKV
EELHFDAVLHDSHDEDQIHLSPLDFPRPMFGLAVEAASKGQEQKLATALHKLSEEDPCFV
VEHEAETNETVIRGLSDLHLRINLERLKERYGVEVTSRPPRIAYRETVSGKAEGHHRHKK
QTGGAGQFGEVFLRIEPLPRGTGFEFVDEVKGGTIPGQFMPAVEKGVRQVLQSGALAGYP
IQDVRVIVYDGKHHPVDSKEVAFVAAGKKAFLDAIGKARPQVLEPIVELEVNAPEQHMGD
VSGGLASKRARISGTDSVRGNEIVVKAQVPLSELEGYAAELKSVTAGRGRYSLDFSHYEP
VPSNVQQKLVEAYKPRHEED