Protein Info for ABIE51_RS15510 in Lysobacter sp. OAE881

Annotation: transporter associated domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00571: CBS" amino acids 80 to 137 (58 residues), 29.8 bits, see alignment E=6.1e-11 amino acids 151 to 200 (50 residues), 25 bits, see alignment 2e-09 PF03471: CorC_HlyC" amino acids 220 to 292 (73 residues), 70.4 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 46% identical to CORC_HAEIN: Magnesium and cobalt efflux protein CorC (corC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 83% identity to xal:XALc_2086)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>ABIE51_RS15510 transporter associated domain-containing protein (Lysobacter sp. OAE881)
MSEDDSSSFHSPEHQEKRADRRGHEKPRSWLERISSALSGEPTTREDLVELLRDAQADGL
IAADTLRMMEGAIAVSDLTVGDVMIPRSQMVSLPADAKFLDLMKQVVESGHSRFPVHGED
KDEILGVLLAKDLLRGVVADNGPGSIHELLRPAVLIPESKRLNVLLREFRQSRNHMAIVI
DEHGGVAGLVTIEDVLEQIVGEIDDEHDDAEDPNALIAAQADGQFVVDALTPISDFNERF
GADFDDDEYDTIGGLVTAAIGHLPEAGEELTLGRFVFRVSGADARRVHAFHVGVLGDA