Protein Info for ABIE51_RS15435 in Lysobacter sp. OAE881

Annotation: cytochrome bc complex cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 42 to 66 (25 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details PF00033: Cytochrome_B" amino acids 32 to 220 (189 residues), 236.8 bits, see alignment E=2.6e-74 PF13631: Cytochrom_B_N_2" amino acids 102 to 277 (176 residues), 153.9 bits, see alignment E=6.4e-49 PF00032: Cytochrom_B_C" amino acids 290 to 393 (104 residues), 123.4 bits, see alignment E=6.8e-40

Best Hits

Swiss-Prot: 61% identical to CYB_ALLVD: Cytochrome b (petB) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 88% identity to sml:Smlt1605)

MetaCyc: 51% identical to cytochrome b (Acidithiobacillus ferrooxidans)
RXN-15829 [EC: 7.1.1.8]

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2 or 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>ABIE51_RS15435 cytochrome bc complex cytochrome b subunit (Lysobacter sp. OAE881)
MANIFTKAAGGVMDWVNERAPAMMPAYRKHMTEYYAPKNFNLWYYFGSLALLVLVNQIVT
GIFLTMHFKPSAAEAFSSVEYIMRDVEWGWLIRYMHSTGASMFFIVVYLHMFRGLMYGSY
QKPRELVWILGMLIYLVLMAEAFMGYVLPWGQMSFWGAKVIISLFGAIPVIGNGLTEWIM
GDFLPGDATLNRFFALHVIALPLVLLLLVVLHLGALHEVGSNNPDGVEIKKGPKGNRWDP
NKPADGIPFHPYYTVKDLFGVGFFLIICAFVIFFAPAFGGWFLEHDNFTEANRLVTPEHI
KPVWYYTPYYAMLRVIPHKLSGVLVMFSAIAVLFFVPWLDKSPVKSHRYRGWITKVMLGV
LAICFLWLGKIGAGPGTDPVETIIGRVLTFLYFAFFITMPLWTKLDKTKPVPQRVTMHD