Protein Info for ABIE51_RS15430 in Lysobacter sp. OAE881

Annotation: cytochrome c1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02167: Cytochrom_C1
  • amino acids 42 to 249 (208 residues), 73.8 bits, E=8.4e-25

Best Hits

Swiss-Prot: 49% identical to CY1_ALLVD: Cytochrome c1 (petC) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 73% identity to psu:Psesu_0831)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Protein Sequence (253 amino acids)

>ABIE51_RS15430 cytochrome c1 (Lysobacter sp. OAE881)
MRIVKKFATFAAGLLVSFVALSTNVSAAEGGHLMQSGTDLDDRTSLQNGAKLFMNYCSGC
HSLKYLRYSRMAEDLGLTEDEVMNNLNFTGAKFGEQIHVSMTPEHANQWFGKMPPDLSLI
ARVRGSDWIYTYLKSFYLDESRPLGWNNQLFPNASMPNPLWELQGLQHAEFGDADKATGE
RPVLGLKVTQPGHQNAEEFNRSVRDITAFLEYAAEPAALKRQSLGVWVILFLAMFTLLAY
LLKTEYWRDVDKH