Protein Info for ABIE51_RS15325 in Lysobacter sp. OAE881

Annotation: type IV pilin protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details PF07963: N_methyl" amino acids 9 to 35 (27 residues), 33.1 bits, see alignment 2.8e-12 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 13 to 35 (23 residues), 30.3 bits, see alignment 1.3e-11 PF16732: ComP_DUS" amino acids 36 to 131 (96 residues), 78.3 bits, see alignment E=7e-26

Best Hits

KEGG orthology group: K02655, type IV pilus assembly protein PilE (inferred from 53% identity to xoo:XOO3195)

Predicted SEED Role

"Type IV pilus biogenesis protein PilE" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>ABIE51_RS15325 type IV pilin protein (Lysobacter sp. OAE881)
MNAGALPTRRAARGFTLIELMIVVGVVAILGAIAYPSYTDSVRKGRRGQAKADLLELAQL
AERWKTVNNTYVGFGSPGGDCVLAGDFGRSPRTGTAYYSVCINATATTYTLTARPVTGTD
QARDSRCGELSINQAGVKTKTGTAASVSDCW