Protein Info for ABIE51_RS15265 in Lysobacter sp. OAE881

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 TIGR00168: translation initiation factor IF-3" amino acids 11 to 173 (163 residues), 213.3 bits, see alignment E=8.5e-68 PF05198: IF3_N" amino acids 11 to 79 (69 residues), 113.6 bits, see alignment E=3.8e-37 PF00707: IF3_C" amino acids 86 to 171 (86 residues), 119.3 bits, see alignment E=5.5e-39

Best Hits

Swiss-Prot: 94% identical to IF3_XANAC: Translation initiation factor IF-3 (infC) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 93% identity to psu:Psesu_1116)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>ABIE51_RS15265 translation initiation factor IF-3 (Lysobacter sp. OAE881)
MSTPEKPNRKNQEIRVPRVRVIGSDGEMIGVLSRDEALRMAEDEGLDLVEIQPNADPPVC
KIMDFGKFRFEMQKKANEAKKKTKQVEIKELKFRPVTDEGDYQIKLRNMRRFLEEGDKVK
VNIRFRGREMSHQELGREMAARIEADLGDDIVIESRPRLEGRQMVMMIAPKKKS