Protein Info for ABIE51_RS15080 in Lysobacter sp. OAE881

Annotation: dipeptide epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 14 to 115 (102 residues), 27.5 bits, E=3.2e-10
• PF13378: MR_MLE_C
  • amino acids 138 to 329 (192 residues), 100.2 bits, E=1.4e-32

Best Hits

KEGG orthology group: None (inferred from 60% identity to pzu:PHZ_c2014)

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

• catechol degradation to β-ketoadipate (1/4 steps found)
• catechol degradation III (ortho-cleavage pathway) (1/6 steps found)
• superpathway of salicylate degradation (1/7 steps found)
• aromatic compounds degradation via β-ketoadipate (1/9 steps found)
• mandelate degradation to acetyl-CoA (3/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (7/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.1

Protein Sequence (339 amino acids)

>ABIE51_RS15080 dipeptide epimerase (Lysobacter sp. OAE881)
MTKTARVQLGLRNEDLRLSAPFRISGHVFEVSPVTLVTLQKNGRVGRGEAAGVYYTRDTP
ALMLLMIEKLRDALERGIGRQELRTLLPSGGARNAVDCALWELEAAIAGVPAWELAKMEK
PKPLLTTFTVGADDPGVMAERARAYTHARAIKLKLTGEADLDIARLRAVRAARPEAWIGV
DANQGYVPDTLSQLLPALVDEGVSLLEQPCRRGYEAELDGVDRAVPIAADESILDLDELE
ERAHWFDVVNIKLDKCGGLTEGLMMARRARELGKRVMVGNMVGTSLAMAPAFLLGQFCDI
VDLDGPLFLDHDRKPGVVYADGHVDCPDTVWGTPDAVIA