Protein Info for ABIE51_RS14975 in Lysobacter sp. OAE881

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 651 to 669 (19 residues), see Phobius details PF17203: sCache_3_2" amino acids 52 to 173 (122 residues), 34.1 bits, see alignment E=5.5e-12 PF00672: HAMP" amino acids 215 to 265 (51 residues), 50.8 bits, see alignment 3.5e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 273 to 441 (169 residues), 119.5 bits, see alignment E=6e-39 PF00990: GGDEF" amino acids 276 to 439 (164 residues), 135.3 bits, see alignment E=3.6e-43 PF00563: EAL" amino acids 460 to 697 (238 residues), 238.2 bits, see alignment E=1.8e-74

Best Hits

KEGG orthology group: None (inferred from 60% identity to sml:Smlt3318)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (708 amino acids)

>ABIE51_RS14975 EAL domain-containing protein (Lysobacter sp. OAE881)
MKLRMGLQARFLALMGVAMLVVIALVALLLNRQEQMRREVEGVSRQAMRTMVGQSLRRQG
EAAVTQLAAGLTNPLYYSDLDAVGALARSTLAAPDVRYVIVYDEDGKVVHDGSEDIAHYG
RHMDDPMAKQVIASTALHTQFDDRVMDVSMPILIGQQRVGGVRIGYDMQAMRRLQDQSVD
RLRSRLDTLGQRHVIWIGLLGVGLLVFGALSLWLIQRLLVRPIRRLAESAQEIEAGHFDT
TTPADGRNDEVGDLMRAFDRMSRSLARHDREIRRMAYTDALTGLANRLAFRESLDERLAQ
SDSRQLALLFADIDDFKRVNDTLGHDAGDDVLLECAHRIESAVARVGGEDALLARFGGDE
FVILVQGKDDPQDDVRTLATKLAETLVVDLGAPVEVQGRQVFLGTSIGITLFPEDAASGT
TLMKNGDIAMYQAKVAGKNCFRFYSRAMNQAVERRVHLEQELRGAWDRGELSLVYQPVFR
LVDGAMIGAEALLRWRHPELGFVAPSVFIDVAEQSGLIEVLGPQVLHAACSDAVAWQKVR
KDAEPLFVAVNVSPRQLRNGDLPNVVSACLRDTGLAADLLHLELTETAVIGDELHASALL
SELRGMGVRVWLDDFGTGFSGLSHLRRVPVDGVKIDRSFVADVLRDPDDLALTTAIIAMA
HSLGILVVAEGVEKEGQYAILRERGCDFAQGYWLGHPVTVDEFLQLRA