Protein Info for ABIE51_RS14960 in Lysobacter sp. OAE881

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF13489: Methyltransf_23" amino acids 45 to 152 (108 residues), 31.6 bits, see alignment E=2.6e-11 PF13649: Methyltransf_25" amino acids 52 to 136 (85 residues), 35.7 bits, see alignment E=2.3e-12 PF08241: Methyltransf_11" amino acids 53 to 126 (74 residues), 26.5 bits, see alignment E=1.7e-09 PF08242: Methyltransf_12" amino acids 53 to 138 (86 residues), 43.1 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: None (inferred from 70% identity to psu:Psesu_0779)

Predicted SEED Role

"FIG01112072: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>ABIE51_RS14960 class I SAM-dependent methyltransferase (Lysobacter sp. OAE881)
MTKHYDQAYFERWYRESSKKDHAVGSAARLTRKVALAVATAEYHLERPIRTVLDIGCGEG
AWRAPLLKLRPKASYLGFDSSEYAVRRFGARRNLHFARFADFAQLRPCPPVDLLVCSDVM
HYLETRELDRGLPGLAELCGGVAFLETFTGEDETDGDNVDFHPRPARFYRQRFAKAGFVP
LGSHLWLSPALTDRLVALERPA