Protein Info for ABIE51_RS14940 in Lysobacter sp. OAE881
Annotation: GIY-YIG nuclease family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to Y5558_CUPNJ: UPF0213 protein Reut_B5558 (Reut_B5558) from Cupriavidus necator (strain JMP 134 / LMG 1197)
KEGG orthology group: K07461, putative endonuclease (inferred from 62% identity to dar:Daro_2472)Predicted SEED Role
"COG2827: putative endonuclease containing a URI domain"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (89 amino acids)
>ABIE51_RS14940 GIY-YIG nuclease family protein (Lysobacter sp. OAE881) MSSDADIAAPWYVYLLECRDGSLYTGITTDVARRYAQHLAGKGARYTRSRPPVRLLGQFP HPDRASASRAEHAIKQLRPEQKRALCAGA