Protein Info for ABIE51_RS14730 in Lysobacter sp. OAE881

Annotation: YihY/virulence factor BrkB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 241 to 268 (28 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 15 to 270 (256 residues), 92.1 bits, see alignment E=2.5e-30 PF03631: Virul_fac_BrkB" amino acids 24 to 272 (249 residues), 164.1 bits, see alignment E=2.6e-52

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 60% identity to xal:XALc_0414)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>ABIE51_RS14730 YihY/virulence factor BrkB family protein (Lysobacter sp. OAE881)
MKALVRRAQGSLPADLVRRFVDTELMAQAAALALYAMLSLAPLLLILVWLTSALLPGAQE
SLMQQIGLLAGGEAERVARTVVDNARDRPDTGSIAGWWSVALLFIGATAVFAQLQDVLNK
IFRTDATRLAGAMAWLRKRVFSMGLVLAMGFLLLVSMTVSTLVQLAFSRMEWALPIVMNV
ATWLVYAISFALMYHYLPDRSVGWKRALGGGAITALLFVLGRWLIGWYLRESNPGSAYGS
MGALVLALVWMYYAALIVFIGALITAVIDERRKQKRGGDREAVGDARAHAPVVSRHPGEG
RDPGP