Protein Info for ABIE51_RS14605 in Lysobacter sp. OAE881

Annotation: septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR01222: septum site-determining protein MinC" amino acids 7 to 253 (247 residues), 227 bits, see alignment E=1.3e-71 PF05209: MinC_N" amino acids 8 to 79 (72 residues), 41.6 bits, see alignment E=1.1e-14 PF03775: MinC_C" amino acids 154 to 252 (99 residues), 108.7 bits, see alignment E=1.3e-35

Best Hits

Swiss-Prot: 71% identical to MINC_XANAC: Probable septum site-determining protein MinC (minC) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 71% identity to xac:XAC1226)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>ABIE51_RS14605 septum site-determining protein MinC (Lysobacter sp. OAE881)
MDFELAGELKIGQVGIANLRIRTLDVARLTEEMRGRVQRAPKLFARAAVVIDFGGLTRTP
DEATARALIEGLRDAGVLPVALAYGTTEIERLSEALGLPLLAKFRASYERDEQAPPPAPT
IREPEPPPPPKAAKSAPAAAAPAVANVAPGMIQSAPVRSGQQIYAENRDLTVLTTVGAGA
EVISDGSVHIYGPLRGRALAGAKGNEQARIFCREFHAELVAIAGHYKVMEEIPKELRGKA
VQIWLEDQQLKIAAQD