Protein Info for ABIE51_RS14510 in Lysobacter sp. OAE881

Annotation: arginyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF04376: ATE_N" amino acids 19 to 89 (71 residues), 78.5 bits, see alignment E=5.3e-26 PF13480: Acetyltransf_6" amino acids 85 to 227 (143 residues), 22.2 bits, see alignment E=2e-08 PF04377: ATE_C" amino acids 109 to 235 (127 residues), 132.1 bits, see alignment E=2.6e-42

Best Hits

Swiss-Prot: 72% identical to BPT_XANOP: Aspartate/glutamate leucyltransferase (bpt) from Xanthomonas oryzae pv. oryzae (strain PXO99A)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 71% identity to psu:Psesu_2127)

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>ABIE51_RS14510 arginyltransferase (Lysobacter sp. OAE881)
MGTEPQDSDDLRLFHTGEHACGYWPERAARDLVLDPRDPRLRHWYPHALSWGFRRSGDIV
YRPHCAGCRACVAVRIPVDRFVPDRSQRRCLTRNANVEMRVLPAHRTAEQLALYRRYLAS
RHAGGGMDGHGASEFDQFLIGSWSEGRFLELREPSRQGPGRLLAVAVTDCTDVSLSAVYT
FYEPDQADRGLGTLAILRQIEWARRERRRHVYLGYWIEGHPKMDYKRRFRPLEAFDGRQW
HDLP