Protein Info for ABIE51_RS14495 in Lysobacter sp. OAE881

Annotation: acyl-CoA thioesterase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR00189: acyl-CoA thioesterase II" amino acids 17 to 288 (272 residues), 294.9 bits, see alignment E=3.2e-92 PF13622: 4HBT_3" amino acids 38 to 114 (77 residues), 66.7 bits, see alignment E=2.8e-22 PF20789: 4HBT_3C" amino acids 134 to 287 (154 residues), 95.1 bits, see alignment E=6.8e-31 PF02551: Acyl_CoA_thio" amino acids 179 to 286 (108 residues), 110.9 bits, see alignment E=6.6e-36

Best Hits

Swiss-Prot: 42% identical to TESB_HAEIN: Acyl-CoA thioesterase 2 (tesB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10805, acyl-CoA thioesterase II [EC: 3.1.2.-] (inferred from 82% identity to psu:Psesu_2124)

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>ABIE51_RS14495 acyl-CoA thioesterase II (Lysobacter sp. OAE881)
MTSPANEQVVHELVELLSLERLEDNLFRGQSRDIGTKYVFGGQVLGQALSAAQATMQAPR
GAHSLHAYFLRAGDIAAPIVYQIDRTRDGGSFSVRRVTAIQHGEVIFFMAASFQQTEDAA
EHQLSMPEVPKPEDIDPAPALPEHVMATLPTKVQRWLSRKGPFELRHVYPRDELNPPKRP
PYQQFWFRLTERVGDAPELHRALLAYASDFHLLGTATFPHGVSYYQPNVQMASLDHALWF
HRPFRADEWLLYSMDSPTVQSSRGLARGQIFDRAGHLVASTAQEGLIRVVKDAAAASHVP
AKE