Protein Info for ABIE51_RS14305 in Lysobacter sp. OAE881

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF21320: HTH_65" amino acids 25 to 94 (70 residues), 59.3 bits, see alignment E=1.6e-19 PF13489: Methyltransf_23" amino acids 153 to 285 (133 residues), 55.4 bits, see alignment E=2.7e-18 PF00891: Methyltransf_2" amino acids 170 to 281 (112 residues), 23.9 bits, see alignment E=1.1e-08 PF13847: Methyltransf_31" amino acids 172 to 277 (106 residues), 72.3 bits, see alignment E=1.7e-23 PF05175: MTS" amino acids 172 to 274 (103 residues), 29.9 bits, see alignment E=1.9e-10 PF02390: Methyltransf_4" amino acids 177 to 234 (58 residues), 29.2 bits, see alignment E=2.7e-10 PF13649: Methyltransf_25" amino acids 177 to 269 (93 residues), 56.4 bits, see alignment E=1.9e-18 PF08241: Methyltransf_11" amino acids 178 to 272 (95 residues), 53.9 bits, see alignment E=1e-17 PF08242: Methyltransf_12" amino acids 178 to 270 (93 residues), 56.3 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: None (inferred from 59% identity to cti:RALTA_A1103)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>ABIE51_RS14305 class I SAM-dependent methyltransferase (Lysobacter sp. OAE881)
MNAINEDRLNQFLGQAVGDLGAAMSATLMLVGDQLGLYRALAEKPMNAADLARHTGTNER
YIREWLGNQAAGGYVDYDRESDTYSLSAEQALCLADPGGPVDLPGAYSIVEATFHALEKT
KANFRTGQGMEWGEHHPCLFHGTERFFRAGYNAHLVTEWLPALDGVVDKLRAGGKAADVG
CGHGASTSLMARAFPNSTFFGFDYHVPSIDVARERAKQAGATNARFEAADATGYTEKDFD
LICFFDCLHDMADPVGAARHALQALKPDGTCMLVEPFAGDSVAENLNPVGRVYYGASSQI
CVPVSLARNGPALGAQAGEARLRKVMTDAGFTRFRRATQTPFNLVFEARP