Protein Info for ABIE51_RS14280 in Lysobacter sp. OAE881

Annotation: two-component system response regulator CreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 99.6 bits, see alignment E=1.2e-32 PF00486: Trans_reg_C" amino acids 147 to 222 (76 residues), 85.3 bits, see alignment E=2.6e-28

Best Hits

Swiss-Prot: 40% identical to RESD_BACSU: Transcriptional regulatory protein ResD (resD) from Bacillus subtilis (strain 168)

KEGG orthology group: K07663, two-component system, OmpR family, catabolic regulation response regulator CreB (inferred from 65% identity to psu:Psesu_1876)

Predicted SEED Role

"Two-component response regulator CreB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>ABIE51_RS14280 two-component system response regulator CreB (Lysobacter sp. OAE881)
MRILLVEDEPAIAQVVTHALRAEGFEAVHCLTGGDALAAARGQDFDLVVLDVGLPDIGGF
ALCRQLRRERDLPVIFLTAQDAEADRILGLEIGADDYVTKPFSPRELVARVRVVLRRMQP
PQPATTPQNNAVFAHDAEGHRIRYRGRVLDLTRYEYGLLAALLQRPGAVLSRAQLMDRVW
GDALESGDRTVDTHIKTLRAKLRDVSPDEDPIRTHRGLGYSLEAGA