Protein Info for ABIE51_RS14160 in Lysobacter sp. OAE881

Annotation: trigger factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF05697: Trigger_N" amino acids 1 to 142 (142 residues), 129 bits, see alignment E=1.8e-41 TIGR00115: trigger factor" amino acids 11 to 413 (403 residues), 352.4 bits, see alignment E=1.6e-109 PF05698: Trigger_C" amino acids 262 to 415 (154 residues), 120.5 bits, see alignment E=7.2e-39

Best Hits

Swiss-Prot: 73% identical to TIG_XANAC: Trigger factor (tig) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K03545, trigger factor (inferred from 73% identity to xac:XAC1077)

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>ABIE51_RS14160 trigger factor (Lysobacter sp. OAE881)
MQVSVESLGNLERRMTFSLPADRLEAQVGGRLREISRGAKIKGFRPGKVPAKVIEQRFGA
QVRADVLNDLLREGFSTAIREQSLQIAGNPQIVPAQGEDALSYVATFEVVPDFGDIDVAK
LNVVRHTSEVSDADIDAMIENLRLQRRTWNPVEREAAAGDAVEIETYSQVGDERLPAEGV
ERGATIIGSAAMFPAIESALVGMKAGDEKDVDVDFPADWRVPAFAGKTVKVHLVATKVSE
PVLPEVDAAFIKSFGVRSGDPDQFRVDIRSNLERELKGALMTRLRREVGEQLIASYSHVE
MPPKLVEAEARDMARQTIETARRQGRAIGEIPADAHVGFMDAARKRVLVGLLVGEIARRN
ELRLEPKRVTETLNLIASTYEEPQQVIELYRNDAQLMNGLQARVMEEQVIDWIAERAQHT
EQPLSFNEAIRQ