Protein Info for ABIE51_RS14055 in Lysobacter sp. OAE881

Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 15 to 342 (328 residues), 348 bits, see alignment E=2.4e-108 PF04055: Radical_SAM" amino acids 27 to 188 (162 residues), 112.3 bits, see alignment E=4.4e-36 PF13353: Fer4_12" amino acids 29 to 100 (72 residues), 23.1 bits, see alignment E=1.2e-08 PF06463: Mob_synth_C" amino acids 199 to 322 (124 residues), 128.5 bits, see alignment E=2.3e-41

Best Hits

Swiss-Prot: 70% identical to MOAA_XANCB: GTP 3',8-cyclase (moaA) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 71% identity to xal:XALc_0606)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>ABIE51_RS14055 GTP 3',8-cyclase MoaA (Lysobacter sp. OAE881)
MNAASQPLTATMPLDVRGRPLRDLRLSVIEACNFRCPYCMPADRLPDDYGFDSATRLSFD
EIETLVRGFAQLGVNKLRLTGGEPLLRKNLPSLIQRLARIPGLDDIALTTNGSLLAAQAR
ALREAGLGRITVSLDAMNPARFRDMTGGRGELSDVLAGLEAARAAGFESIKINCVVERGI
NDDQVLPLVSHFRGTGHVVRFIEFMDVGTCNDWSRDRVVPSAELRDRIAARWPLRALEAN
YRGEVASRYAFEDGQGEVGFVSSVSAPFCGDCHRARVSADGRLYTCLFAGDGHDLRPALS
QGVDALRERVSTIWTRRGDRYSEMRGGVGASRKHVEMFLIGG