Protein Info for ABIE51_RS13930 in Lysobacter sp. OAE881

Annotation: aminodeoxychorismate synthase component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04715: Anth_synt_I_N
  • amino acids 15 to 144 (130 residues), 29.2 bits, E=1.1e-10
• TIGR01824: aminodeoxychorismate synthase, component I
  • amino acids 95 to 446 (352 residues), 433.2 bits, E=4.4e-134
• PF00425: Chorismate_bind
  • amino acids 186 to 443 (258 residues), 296.1 bits, E=2.4e-92

Best Hits

KEGG orthology group: K01657, anthranilate synthase component I [EC: 4.1.3.27] (inferred from 72% identity to psu:Psesu_2000)

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (16/18 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Folate biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 4.1.3.27

Use Curated BLAST to search for 2.6.1.85 or 4.1.3.27

Protein Sequence (455 amino acids)

>ABIE51_RS13930 aminodeoxychorismate synthase component I (Lysobacter sp. OAE881)
MLLTHSLPTSFDLLALQRLAPARYPLLLESSAHGTAQGRWDLLLVADGGQLRLDVDATVR
DENGTGIGTDFFAALDAQWQAERVPRDEPRWPFRGGWALLFGYEAAAQVEPILSLPRAEG
RLPVALALRCPAAVLRDHTSGECVLVVETAHETLRDDVLDDIAQLAAQPPLPAWHAPVAL
DEDEPDRFTDGVRRVLDYLAAGDVFQANLSRGWRARFGRDVQAAELFQRLRENNPAPFAG
VFAGDDWAVVSASPERLVSVRGDVVETRPIAGTRPRFDGDDDAARIQELVGHPKERAEHV
MLIDLERNDLGRVCTPGSVEVDELMTVESYAHVHHIVSNVRGRLRSDATPGQVIRAVFPG
GTITGCPKVRCMQIIAELEGVGRGAYTGAMGWLNRDGDMDLNILIRSAELESTPDGATLR
FRTGAGIVADSDPRKELDETRAKARGMLRALGVAG