Protein Info for ABIE51_RS13925 in Lysobacter sp. OAE881

Annotation: aminodeoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03461: aminodeoxychorismate lyase
  • amino acids 17 to 256 (240 residues), 228.1 bits, E=5.3e-72
• PF01063: Aminotran_4
  • amino acids 27 to 240 (214 residues), 154.7 bits, E=1.8e-49

Best Hits

KEGG orthology group: K02619, 4-amino-4-deoxychorismate lyase [EC: 4.1.3.38] (inferred from 45% identity to nhl:Nhal_3120)

Predicted SEED Role

"Aminodeoxychorismate lyase (EC 4.1.3.38)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 4.1.3.38)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• 4-aminobenzoate biosynthesis II (1/2 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.38

Protein Sequence (271 amino acids)

>ABIE51_RS13925 aminodeoxychorismate lyase (Lysobacter sp. OAE881)
MSVRHFVGEQAVANTPDHDRGLAYGDGLFETMRAHEGNVHWWPAHWRRLERGAHAIGIAL
PDQARVRHEAQALLDGAGGVLKLIVTRGVGGRGYAPFDANSPHWIVSRHDAPPAAPADGL
TLRWCDTRLAVQPALAGIKHCNRLEQVLARAEWRDADVDEGLMRSTEGDVVSATAANLFV
LLGGRWTTPAVDRCGIAGVCREWAIDALQAREARLAVTEVEAAEAVFLCNAARGILPVAR
LGARVWRPHPQVAQLRRRLAAEHPAFATEVA