Protein Info for ABIE51_RS13530 in Lysobacter sp. OAE881

Annotation: polyhydroxyalkanoate synthesis repressor PhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR01848: polyhydroxyalkanoate synthesis repressor PhaR" amino acids 5 to 111 (107 residues), 176.9 bits, see alignment E=5.9e-57 PF07879: PHB_acc_N" amino acids 6 to 65 (60 residues), 102.1 bits, see alignment E=1.4e-33 PF05233: PHB_acc" amino acids 70 to 109 (40 residues), 67.1 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 45% identical to Y064_ALLVD: Uncharacterized protein Alvin_0064 (Alvin_0064) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 80% identity to xac:XAC2402)

Predicted SEED Role

"PhbF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>ABIE51_RS13530 polyhydroxyalkanoate synthesis repressor PhaR (Lysobacter sp. OAE881)
MASMRVIKKYPNRRLYDTEISSYITIEDVRQLIVDGEEFEVRDARSGEDLTRQVLLQIIA
EHEQDGEPVLSTQLLSQIIRFYGDSLQGFMGSYLERSMQVFLDQQQQFRNQMGGILGQTP
WALMNQLTERNLQMWNEFQRNLSGNVGQSTTPPPNKAKGGEQKR