Protein Info for ABIE51_RS13485 in Lysobacter sp. OAE881

Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00702: Hydrolase" amino acids 10 to 185 (176 residues), 110 bits, see alignment E=4.2e-35 PF12710: HAD" amino acids 12 to 182 (171 residues), 43 bits, see alignment E=1.4e-14 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 12 to 210 (199 residues), 234 bits, see alignment E=2.1e-73 PF13419: HAD_2" amino acids 12 to 190 (179 residues), 117.4 bits, see alignment E=1.6e-37 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 96 to 190 (95 residues), 31.1 bits, see alignment E=3.7e-11 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 96 to 185 (90 residues), 32.8 bits, see alignment E=1.3e-11 PF13242: Hydrolase_like" amino acids 146 to 198 (53 residues), 39.7 bits, see alignment E=7.5e-14

Best Hits

Swiss-Prot: 65% identical to GPH_XANCP: Phosphoglycolate phosphatase (gph) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 65% identity to xca:xccb100_1910)

MetaCyc: 46% identical to N-acetyl-beta-muramate 6-phosphate phosphatase (Pseudomonas putida KT2440)
RXN-18659 [EC: 3.1.3.105]

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ubiquinone biosynthesis SAM-dependent O-methyltransferase" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.105 or 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>ABIE51_RS13485 phosphoglycolate phosphatase (Lysobacter sp. OAE881)
MAADAVAYPKAVLFDLDGTLLDSAPDMVAAIDAMRAARGQPPMPLEQLRPHVSKGARAMV
AAAFPDVPDDERERWIPEFLDCYQRALGHHGMLFEGVDAMLEALENAGCTWGIVTNKPEY
LARQLMPVLGWEQRCAVLIGGDSLSARKPDPLPLIVAAERIGVAPEQCVYVGDDERDIIA
ARAAGMPSVVALWGYRLDEDNPIAWQGDVMIDVPSQLIAADAWPGTR