Protein Info for ABIE51_RS13380 in Lysobacter sp. OAE881

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 24 to 390 (367 residues), 298.7 bits, E=4.2e-93
• PF00206: Lyase_1
  • amino acids 32 to 297 (266 residues), 163.7 bits, E=3.7e-52

Best Hits

Swiss-Prot: 77% identical to ARLY_STRM5: Argininosuccinate lyase (argH) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 74% identity to xal:XALc_1889)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (8/10 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• urea cycle (3/5 steps found)
• canavanine biosynthesis (2/4 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine biosynthesis IV (archaea) (3/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Protein Sequence (430 amino acids)

>ABIE51_RS13380 argininosuccinate lyase (Lysobacter sp. OAE881)
MSDLLWQKPGVKVDARIQKFLAGEDVILDREFFVFDIEASRAHAQGLQQIGILAADELAG
LERELSLLADDFNAGRFVLDDQYEDGHSAIEARLVERLGDAGKKIHTGRSRNDQILVATR
LWLKDRLSRLLATCRESAQVALARAEAEQAVPLPGYTHLQRAVVSSLGMWWAAWAEGFVD
DAQRAADTLAWVDANPLGSAAGYGVNLPLARDHTTQALGFGRMQVSAAYAQLSRGKFEMA
AIEALTSALLDLRRLAWDLSLFTSAEFGFVALPSQYTTGSSIMPNKRNPDVIELMRASYS
AAAAARTEIEQLLSLPSGYHRDLQFSKGAIFHAFGRGLDALELLPDLLRNLEWKTERMRE
ALDPSMYATDLAVDMAREGLPFREAYRLAADPARWAEGDPDASLRARVSPGASGELRLDA
LKERLARLAE