Protein Info for ABIE51_RS13370 in Lysobacter sp. OAE881

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 TIGR01027: glutamate 5-kinase" amino acids 16 to 368 (353 residues), 364.6 bits, see alignment E=2.9e-113 PF00696: AA_kinase" amino acids 16 to 232 (217 residues), 123 bits, see alignment E=1.7e-39 PF01472: PUA" amino acids 279 to 353 (75 residues), 68.1 bits, see alignment E=5.1e-23

Best Hits

Swiss-Prot: 62% identical to PROB_XYLFA: Glutamate 5-kinase (proB) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 65% identity to xoo:XOO2666)

MetaCyc: 45% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>ABIE51_RS13370 glutamate 5-kinase (Lysobacter sp. OAE881)
MNGSDFTAQPLPPWRRAVLKVGSSLLSGEDGLDPRHAGALARFIEHARTQQREIVLVSSG
AVAAGRHRIAAGGENLVLRQALASLGQAALVTFWQQLVDRPVAQVLLTHDDLRNRRRYLN
ARATLRELLRLGALPVINENDTVAVDELKLGDNDNLAAAVASLVDADLLLIATDIGGLYS
AHPRDPAAQAIMRVETITPELLQAASGGAGTLGTGGMRTKLDAAAKAGAAGIATALFCGR
DADVVRALHDDVLHGTLVLAQGDRLRARKQWLRHAPSSGRLHVDAGAFAALHRQGASLLP
GGVVSAKGEFRRGDVVEIGVEHEPAFARGLAQYGANEVRRIARRHSNEIEAILGFRYGES
VVHRDDLVLIDATSHKETST