Protein Info for ABIE51_RS13260 in Lysobacter sp. OAE881

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 137 (32 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 279 to 304 (26 residues), see Phobius details amino acids 326 to 349 (24 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details amino acids 403 to 422 (20 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details amino acids 460 to 480 (21 residues), see Phobius details PF13520: AA_permease_2" amino acids 40 to 474 (435 residues), 200 bits, see alignment E=6.9e-63 PF00324: AA_permease" amino acids 42 to 422 (381 residues), 145.2 bits, see alignment E=2.7e-46

Best Hits

Swiss-Prot: 48% identical to YHDG_BACSU: Uncharacterized amino acid permease YhdG (yhdG) from Bacillus subtilis (strain 168)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 76% identity to xfa:XF2207)

Predicted SEED Role

"Amino acid transporters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>ABIE51_RS13260 amino acid permease (Lysobacter sp. OAE881)
MFKNLFLTKPVEPAGHVDAGEPVEGSLQGEATLKRSLTATQLVMLGIGAVIGAGIFVLSG
HAAAEHAGPAIVISFIIAGFACALAGLCYAEFAAMLPVSGSAYSYSYATLGEFVAWFIGW
NLVLEYMFAASTVAVGWSGYLNSFLGSFNMALPASLAAAPLNVVEGSIVYTGGLINLPAV
FIVAALSGLCYVGITQSAIVNSVIVAIKVIVIVMFVAFAAQYVNPDNWVPFVPENQGPGR
YGIDGIIRGASVVFFAYIGFDAVSTAAGEAKNPQRDMPIGILGSLVICTIIYIIVALVLT
GLLPYPQLSTPKPVATALEAYPSLLWLKHVVELGAIAGLSSVILVMLMGQPRIFYSMAKD
GLLPKVFAKVHPKFQTPYMGTIYVGVFACLLAGFLPIGLLGELVSMGTLLAFATVSIGVL
VLRKSRPDLPRPFRVPAASIICPLGAAACLYLFWKPFSEHWPLMTGWTVIGLLIYFFYGY
RNSKVRQAAR