Protein Info for ABIE51_RS12825 in Lysobacter sp. OAE881

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13477: Glyco_trans_4_2
  • amino acids 2 to 133 (132 residues), 63.4 bits, E=8.4e-21
• PF13439: Glyco_transf_4
  • amino acids 22 to 181 (160 residues), 43.9 bits, E=7.9e-15
• PF13579: Glyco_trans_4_4
  • amino acids 23 to 174 (152 residues), 61.5 bits, E=3.7e-20
• PF00534: Glycos_transf_1
  • amino acids 191 to 353 (163 residues), 84.6 bits, E=1.8e-27
• PF13692: Glyco_trans_1_4
  • amino acids 196 to 336 (141 residues), 85.8 bits, E=1e-27
• PF13524: Glyco_trans_1_2
  • amino acids 289 to 360 (72 residues), 29.1 bits, E=2.9e-10

Best Hits

KEGG orthology group: None (inferred from 55% identity to bpy:Bphyt_4709)

Predicted SEED Role

"Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-); Putative glycosyltransferase" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (396 amino acids)

>ABIE51_RS12825 glycosyltransferase family 4 protein (Lysobacter sp. OAE881)
MRIVFFANTDWYLYNFRLPAAMQLQAQGAEVVMVSPEGPYGERFAKNGIRWETLPMDRAS
LNPLREAVTIKHLAALLRRERPDLIHNFTVKCAVYGAMAARLSGVPAVVNAVAGLGYVYA
SNGLKARVLRPVVSTLMRSTLGSGNSRVILQNPDDAEALTKLRLVREDRIRVIRSSGVNV
ERFQPATGRADGAPLRVLLAARLLREKGIGEYVEAARMLKERGRNVEFLLAGTPDYGNPS
SFQGEEVQAWHDAGLIQWLGHVDDMPALMASVDVMALPSYYREGVPRCLIEGAASGLCIV
TTNLPGCREVVTTHGEDGLQVPPRDAASLAALIMQLDDDRAQVRRLGAKARERALAHFDE
RLVIGRTLDVYRELLSSDVLAAPRPARTPTLDCARE