Protein Info for ABIE51_RS12620 in Lysobacter sp. OAE881

Annotation: fumarate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05681: Fumerase
  • amino acids 24 to 298 (275 residues), 320.1 bits, E=1.1e-99
• TIGR00722: hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S type
  • amino acids 25 to 298 (274 residues), 206.2 bits, E=5.7e-65
• PF05683: Fumerase_C
  • amino acids 302 to 501 (200 residues), 285.8 bits, E=1.6e-89
• TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type
  • amino acids 338 to 500 (163 residues), 162.4 bits, E=9.9e-52

Best Hits

KEGG orthology group: K01676, fumarate hydratase, class I [EC: 4.2.1.2] (inferred from 94% identity to sml:Smlt3222)

Predicted SEED Role

"Fumarate hydratase class I, aerobic (EC 4.2.1.2)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• methylaspartate cycle (11/19 steps found)
• reductive TCA cycle II (5/12 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Protein Sequence (518 amino acids)

>ABIE51_RS12620 fumarate hydratase (Lysobacter sp. OAE881)
MSNTATQPFAASQPVSIRQEDLIQSIADGLQYISYYHPVDYIQNLAAAYEREESPAAKDA
IAQILINSRMCAEGHRPICQDTGIVTVFLEIGMSVRWDDATMSVEDMVHEGVRRAYNHPD
NKLRASVLADPAGKRTNTKDNTPGVVNVKVVPGNKVDVIVAAKGGGSEAKSKFAMLNPSD
SIVDWVLKTVPTMGAGWCPPGMLGIGIGGTAEKAMLLAKESLMEPIDITDLQARGPSNRA
EELRLELYEKVNALGIGAQGLGGLTTVLDIKVKDYPTHAANLPVAMIPNCAATRHAHFTL
DGSGPVMLDPPSLADWPELTYDASKGRRVNLDTLTKEDVASWKPGEVLLLNGKLLTGRDA
AHKRMVDMLNKGEGLPVDLRGRFIYYVGPVDPVRDEVVGPAGPTTATRMDKFTEQVLAQT
GLLGMVGKAERGPAAIEAIRKHQSAYLMAVGGAAYLVSKAIKAAKVVGFADLGMEAIYEF
EVQDMPVTVAVDSTGESVHKTGPREWQARIGKIPVVVE