Protein Info for ABIE51_RS12405 in Lysobacter sp. OAE881
Annotation: very short patch repair endonuclease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to VSX2_XANOR: XorII very short patch repair endonuclease (vsr) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
KEGG orthology group: K07458, DNA mismatch endonuclease, patch repair protein [EC: 3.1.-.-] (inferred from 63% identity to psu:Psesu_2195)Predicted SEED Role
"Very-short-patch mismatch repair endonuclease (G-T specific)" in subsystem DNA repair, bacterial
Isozymes
Compare fitness of predicted isozymes for: 3.1.-.-
Use Curated BLAST to search for 3.1.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (145 amino acids)
>ABIE51_RS12405 very short patch repair endonuclease (Lysobacter sp. OAE881) MADTLTPQARSERMGRIRSKDTRPELLVRRAVWRAGFRYRLHVKGMPGRPDLVFPRLRTV VFVHGCYWHAHTCQKGRIPGANRQFWHDKFMANQSRDERDRAELRRLGWRVIVVWECALA SAARRESTLRGVLDKLREVPPGSSP