Protein Info for ABIE51_RS12160 in Lysobacter sp. OAE881

Annotation: protein-methionine-sulfoxide reductase heme-binding subunit MsrQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 56 to 74 (19 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details PF01794: Ferric_reduct" amino acids 53 to 167 (115 residues), 75.6 bits, see alignment E=1.8e-25

Best Hits

Swiss-Prot: 72% identical to MSRQ_XANOR: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: None (inferred from 72% identity to xom:XOO_2270)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>ABIE51_RS12160 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Lysobacter sp. OAE881)
MPPSTRTLIATKTLVHALALTPAAILAWQIRAEFLTGSGGLGADPVAEIEHRLGLWALRF
LMLTLAITPLRQLTGQPVLMRFRRMLGLYAFAYATLHFTAYLVLDLRGYWTQIFEEIAKR
PYITVGFAAWLLLVPLALTSTQAAIRWLGRNWARLHKLVYVIAVLAVLHFWWLVKSDVRE
PALYAGILAVLLGWRAWNALKKRKLSARRKAAAG