Protein Info for ABIE51_RS11685 in Lysobacter sp. OAE881

Annotation: CHASE domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details PF03924: CHASE" amino acids 94 to 275 (182 residues), 176.5 bits, see alignment E=1.4e-55 TIGR00229: PAS domain S-box protein" amino acids 361 to 484 (124 residues), 63.1 bits, see alignment E=1.4e-21 PF08448: PAS_4" amino acids 379 to 479 (101 residues), 35.7 bits, see alignment E=2.2e-12 PF13426: PAS_9" amino acids 381 to 477 (97 residues), 36.9 bits, see alignment E=9.3e-13 PF00512: HisKA" amino acids 511 to 574 (64 residues), 39.1 bits, see alignment E=1.6e-13 PF02518: HATPase_c" amino acids 618 to 729 (112 residues), 79.6 bits, see alignment E=6e-26

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (733 amino acids)

>ABIE51_RS11685 CHASE domain-containing protein (Lysobacter sp. OAE881)
MSPEAVREDRTPDLSELSPRRGYLLALIVLVGSLLLVFTAWRAARERELRSAEAEFISKT
AEVTELLRQGMTKYELVARGGVSMFASVTRPRPSPAQWQAYVDGMDLQRRFPGMVGLGFA
EFVPATRLADLQLEWRDAGHGLLEIWPRGQRRDYGPILYLEPKTPANVGAIGFDMYSEPV
RQAAMVQAMETGNATLSGPVHLIQDGSLRSTGILLYLPVYRGGGRPATLANRRADMQGWV
YVPVRMEGFVRNALGALRNDSQFRVIDVSAGERLLYATYAPADRPPPAFRHSSAFELYGR
HWRVDFESPPVAQAAPRLQGLQNLLALGLFSSLLLYAIAWMLARTEAQAYRIAVRMTEDY
RRSELRFRSAMRYSAIGKALLDSEGHIVEANPALANIVGLTPEALVGKRFDTLFESDEPE
LIAYGHGTTDAQGVHRATRRLHREGGDPRQAQLTYAPVPGNVGQDIVGLVQVEDVTERLR
AEARVHALNRTLEARVALRTRELSQANQELEAFAYSVSHDLRAPLRAIDGFSRILIERHS
AGMDENGRGYLVRVRRAAGRMGELIDALLKMSRVSRSELRLERVDLSRLAGEVIEELRVS
DSRRQVEVDIQPELFVIGDAPLLRNLLGNLLGNAWKFTRDRLDARIEFGAVMGEQGLEYF
VRDNGAGFSQAYVDKLFRPFQRLHHNDDFAGHGIGLASVKRIVERHGGTIRAEGEVGKGA
TFWFTLPREKLAE