Protein Info for ABIE51_RS11515 in Lysobacter sp. OAE881

Annotation: high frequency lysogenization protein HflD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04356: DUF489" amino acids 4 to 191 (188 residues), 203.6 bits, see alignment E=1.5e-64

Best Hits

Swiss-Prot: 65% identical to HFLD_XANC5: High frequency lysogenization protein HflD homolog (hflD) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K07153, high frequency lysogenization protein (inferred from 65% identity to xcv:XCV2045)

Predicted SEED Role

"FIG002903: a protein of unknown function perhaps involved in purine metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>ABIE51_RS11515 high frequency lysogenization protein HflD (Lysobacter sp. OAE881)
MSTRVLALAGLVQALAQVRRVADTGQANAAILTTAMDSVFRIDAPSPKAVYGDVEALRPG
LTLLRDYFGSSQRDEQLPRLVLAVMQLERRFVRDDDMGRRVQSGIRAQAGNAERMGSTHP
DVMAALGSLYAETLSHLRPRVLVQGNPHYLGQANVVSEVRAILLAAVRSAVLWRQCGGSL
WDFLLRRRDLLAAVRDHLEG