Protein Info for ABIE51_RS11510 in Lysobacter sp. OAE881

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 7 to 357 (351 residues), 410.7 bits, see alignment E=2.2e-127 PF03054: tRNA_Me_trans" amino acids 7 to 199 (193 residues), 241.9 bits, see alignment E=7.9e-76 PF20259: tRNA_Me_trans_M" amino acids 205 to 270 (66 residues), 70.2 bits, see alignment E=1.3e-23 PF20258: tRNA_Me_trans_C" amino acids 282 to 357 (76 residues), 83.8 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 79% identical to MNMA_STRMK: tRNA-specific 2-thiouridylase MnmA (mnmA) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 79% identity to sml:Smlt2332)

MetaCyc: 55% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>ABIE51_RS11510 tRNA 2-thiouridine(34) synthase MnmA (Lysobacter sp. OAE881)
MSTAPRTVVGMSGGVDSSVAALRLRDEGEAIAGLFMQNWDDDGSGDCRAEDDRRDAVAVS
GRLGIPIHFRDFSGQYWKGVFEHFLAEYAAGRTPNPDVLCNREIKFKHFLDAARALGAEF
IATGHYARVEARDGRHLLLRAVDRSKDQSYFLHQLGQAQLSATKFPLGGLLKRDVRQMAL
DAGLPTAAKKDSTGICFIGERDFREFLGRYLPAREGEMRTPDGQVIGRHPGVFYFTLGQR
EGLNIGGVRGFEAAPWYVVGKDVGANVLYVDQGSDSRWLHSQALWSEAAHWIAGSPPAKR
FECTAQTRYRQADEACEVDVRDDGTLSVRFARAQRAVTPGQSLVLYDGDVCLGGAVIAAT
DAPLEERLKARAA