Protein Info for ABIE51_RS11360 in Lysobacter sp. OAE881

Annotation: azurin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00127: Copper-bind" amino acids 24 to 149 (126 residues), 66.4 bits, see alignment E=1.3e-22 TIGR02695: azurin" amino acids 25 to 147 (123 residues), 158.5 bits, see alignment E=4.6e-51

Best Hits

Swiss-Prot: 53% identical to AZUR_ALCFA: Azurin from Alcaligenes faecalis

KEGG orthology group: None (inferred from 63% identity to psu:Psesu_0350)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>ABIE51_RS11360 azurin (Lysobacter sp. OAE881)
MKTALLLAGLALAGVSSHASAADNCTVRIKANDAMQYDIKTATVSASCPAITIELTHTGK
MPVAAMGHNVVVSQTVLYDAIARDGLKAGAAAGYVPKNDPRVIAATALIGGGQSTKTTFA
GSRLKAGGDYAFYCSFPGHATLMRGKLIVVK