Protein Info for ABIE51_RS11195 in Lysobacter sp. OAE881

Annotation: metalloregulator ArsR/SmtB family transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF12840: HTH_20" amino acids 16 to 62 (47 residues), 55.5 bits, see alignment E=4.3e-19 PF01022: HTH_5" amino acids 18 to 63 (46 residues), 42.6 bits, see alignment E=4.3e-15

Best Hits

KEGG orthology group: None (inferred from 66% identity to cja:CJA_3742)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>ABIE51_RS11195 metalloregulator ArsR/SmtB family transcription factor (Lysobacter sp. OAE881)
MVESNSDRLDAVFRALADPTRRAMVRNLARQPRSVGELAEPFEISLAAASKHIKVLEGAG
LVQRDVQGRTHVCRLDARPLHAGMEWMRHYEQFWNQRLGALEDLLRAEDRDDATRKPPRK
PAAKPARSNRSKR