Protein Info for ABIE51_RS11165 in Lysobacter sp. OAE881

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details PF06779: MFS_4" amino acids 28 to 382 (355 residues), 39 bits, see alignment E=6.7e-14 PF07690: MFS_1" amino acids 30 to 278 (249 residues), 112.6 bits, see alignment E=2e-36 amino acids 269 to 404 (136 residues), 69.1 bits, see alignment E=3.3e-23

Best Hits

KEGG orthology group: None (inferred from 72% identity to vap:Vapar_6311)

Predicted SEED Role

"Oxalate/formate antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>ABIE51_RS11165 MFS transporter (Lysobacter sp. OAE881)
MNRIAAASYPPDRNWPLVASGAVLGCVGVGVIFALAVLLGPMSAATGWSRGALSSAMTLA
FLSMGVGGFVWGALSDRIGPRKVVLVGSLLLGLACVLASRSATLWQFRLTYGVLMGVAVS
SFFAPVIAATASSFEKRRNIAISLVSAGVGVAPMTMSPLVAWLVSHYDWRQTLLIVGFVA
WALTLPAVWFVRASPIPEPASPGTTADATVANAGQALRSRAFIVLAVTYFACCAAHSGPI
FHTVSYAVGCGLAVTTAVTIYSMEGAAGLGGRILFGLMADRLGAKPVLVAGLLIQAVAAV
SYLSVSQLNGFYAVAIVFGMAYGGTMPLYASLAREAFSPQILGLVLGAAGMLSALGMALG
PLLGGWLFDRYGSYTWMYIGSMAVGLGAASIALWFPSKRKPREPETLQVLPQEG