Protein Info for ABIE51_RS11100 in Lysobacter sp. OAE881

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00561: Abhydrolase_1" amino acids 22 to 256 (235 residues), 127.8 bits, see alignment E=1.1e-40 PF12697: Abhydrolase_6" amino acids 23 to 238 (216 residues), 70.3 bits, see alignment E=7.9e-23 PF12146: Hydrolase_4" amino acids 35 to 121 (87 residues), 49.2 bits, see alignment E=9.2e-17 amino acids 205 to 255 (51 residues), 32 bits, see alignment 1.7e-11 PF00326: Peptidase_S9" amino acids 181 to 257 (77 residues), 22.9 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 64% identical to THCF_RHOER: Non-heme haloperoxidase (thcF) from Rhodococcus erythropolis

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 76% identity to bra:BRADO4449)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>ABIE51_RS11100 alpha/beta hydrolase (Lysobacter sp. OAE881)
MSYITTQDGTQIFYKDWGTGQPIVFHHGWPLCGDDWDTQMLYFLAQGYRVIAHDRRGHGR
STQTATGNEMDTYAADVAALAKELDLRDAIHIGHSTGGGEAARYVAKHGKGRVAKLVLIG
AVPPVMVKSASNPGGLDKSVFDGLRDGFAADRAGFYWDFPIPFYGYNRNGAKLSEAVRQN
WWRQGMMGGAKPQYDCIAAFSETDFTEDLKSIEVPTLVMHGDDDQIVPIDDSARLSAKLL
RNATLKVYPGFPHGMCTTHADTINPDLLAFIRS