Protein Info for ABIE51_RS10980 in Lysobacter sp. OAE881

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 32 to 49 (18 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 290 to 318 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 322 (308 residues), 113.8 bits, see alignment E=5.1e-37

Best Hits

KEGG orthology group: None (inferred from 48% identity to xau:Xaut_1228)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>ABIE51_RS10980 AI-2E family transporter (Lysobacter sp. OAE881)
MRDERIPTPLAMLLGIGAVFVILLALYLGRSLFAPVFFAIFIVAIVWPLQDAMEKKLPRV
LAMLVTVVVAGGVMVTLASLVLWSLNRAVLWAIANAAAFQAAYVQMDAWLQGHGLYLASE
FVHNFDPRWLFAALQRLGAGLQYVASFVVIALVFVVLGLLEVEPTRRKLVRANKVELVAA
CRAAAAKFQRYMVIRAVMSLATGLGVWALTYAFGMDLAMEWGVTAFALNFIPFLGPLFAT
MLPTLFAIVQFDNFVVPIAIFVGLNVVQFLIGSYLEPRVAGDRLSISPFLVLFAVFMWSM
LWGIAGAFIGVPILIAAMTFAEHHPTARNWAQLLSGDPARRVRANE