Protein Info for ABIE51_RS10520 in Lysobacter sp. OAE881

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 374 (355 residues), 174.5 bits, see alignment E=1.6e-55

Best Hits

KEGG orthology group: None (inferred from 35% identity to phe:Phep_0456)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>ABIE51_RS10520 MFS transporter (Lysobacter sp. OAE881)
MADGVGAGPGKARWVLLGLLFVSTVINYLDRQALSILATTIQVDLKMSDLEYAHVVQLFL
LAYTVAYLLAGRITDWLGARVSLALFVGWWSIANIVTGLVRTPGELGAARFALGLGEPGN
YTVGAKVVSEQFPPQERGLAYGIYTAGAMVGATLAPPLIGGIALVYGWRAAFWLTGAVGL
VWIVGWWFAYPRDAKGAAPVVAQPASIETEPRREGALWRDLLRDRSLWLLVASRAVADPV
WYFYLFWFPKYLNDERGMTLAAVASMAWVVYLAADFGSVGGGAISSALVRRGMAPARSRI
VAMTGAAMLAPVGLVIAFHPPLPVLFGIASLVAFAHLVFQINISTLIVDLYPSRVVATVF
GLIGAGSAFGGMLSAEVVGRLVQGHNFDRTFVLMAMLHPIALGLGWLAFRWAGRSRLIAQ
DAQPQPT