Protein Info for ABIE51_RS09960 in Lysobacter sp. OAE881

Annotation: carboxymuconolactone decarboxylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF02627: CMD" amino acids 51 to 122 (72 residues), 38 bits, see alignment E=6.7e-14 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 58 to 101 (44 residues), 45.5 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: None (inferred from 77% identity to axy:AXYL_05773)

Predicted SEED Role

"Macrophage infectivity potentiator-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>ABIE51_RS09960 carboxymuconolactone decarboxylase family protein (Lysobacter sp. OAE881)
MSRIPLVNPKDSTGERQQILGQIHSAFGATPNMFRAVANSTAALKSMWGSFGALGDGVIP
PKLGEQIAVAIANRNACEYCLAAHTALGRKAGASGDEMSAAQDGQSQDPRTAAALRFALR
VVEGRGQIETADVEALRAAGFNDEEIVEILAHVALNLFTNYVNVAFAVPVDFPGVKLR