Protein Info for ABIE51_RS09670 in Lysobacter sp. OAE881

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 372 (343 residues), 122.3 bits, see alignment E=1.1e-39

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>ABIE51_RS09670 MFS transporter (Lysobacter sp. OAE881)
MAATDAGLRSETGTSMLGHAMAWWVWILAVTFVVYLFSFQTGYSIVNPSVQKDTGISIAQ
VGTIAAVYTWAFAIAQFFGGALLDRLGARKVLPISIALVTIGIFMFANANSYGMLLLSQI
VIAIGSCTGFVGAGYIGGQWFGMAKFSFMFGLVQVVAALTSAFSVNLIGVALDAMTWRSL
FNWTAAFGIVLFVLGLLYIRNPTPVVSHPGEGNFFASVLRSMAEVAKIGHVWIASLGGAL
SFGAMLALGVVWAPKLLMVHGISERAAALGSSLLWLGLAAGSAVVPLWSDMIRRRKRPII
LGAAVQLLALLGLLFIPDLGAGLAMILCFVFGFANAAHMLAFSTAADVVLPRQIGTSAAI
VNGIMFIFGGILISRPGVRIGMGIEHGIQPASLQLAQYASVPVIVACVLALILAMIMRET
YPAHH