Protein Info for ABIE51_RS09565 in Lysobacter sp. OAE881

Annotation: copper resistance system multicopper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 14 to 607 (594 residues), 1009.4 bits, see alignment E=5e-308 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 14 to 42 (29 residues), 18.4 bits, see alignment (E = 2.1e-07) PF07732: Cu-oxidase_3" amino acids 62 to 172 (111 residues), 134 bits, see alignment E=4.3e-43 PF07731: Cu-oxidase_2" amino acids 83 to 171 (89 residues), 21.6 bits, see alignment E=2.4e-08 amino acids 490 to 608 (119 residues), 105.2 bits, see alignment E=3.8e-34 PF00394: Cu-oxidase" amino acids 215 to 355 (141 residues), 82.8 bits, see alignment E=4.5e-27

Best Hits

Swiss-Prot: 68% identical to PCOA_ECOLX: Copper resistance protein A (pcoA) from Escherichia coli

KEGG orthology group: None (inferred from 73% identity to smt:Smal_3105)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>ABIE51_RS09565 copper resistance system multicopper oxidase (Lysobacter sp. OAE881)
MTSDVFRRRAASPSRRRFVTGLAAGGVATGAGLWHLPGTAVAAPAHSPNMLTGTQFDLSI
DASPVNFTGRTRPAVTVNGSLPAPILRWREGDTVTLRVANRLPVQSSIHWHGLVLPANMD
GVPGLSFDGIGPGETFTYRFDIRQSGTYWYHSHSLFQEQAGLYGAIVIDPREPAPYAFDR
EHVVLLSDWTDLEPAALFRRMKKMAGYDNFHKRTVGDFFDDVSRDGLSATLRDRGQWGRM
RMTPTDLSDINANTYTYLLNGTAPSGNWTGLFRSGEKVLLRFINGSAMTYFDVRIPGLKM
TVVAADGQYIHPVTVDEFRIAVAETFDVIVEPSGQDAYAIFAQDMGRTGYARGTLAVRHG
LVAPLPAQDPRPILTMDDMGHGAMDHAGMGHSGMKPGAKGMEGGCGANMGMKGMEGGCGA
NMGHDMAGMDHGGGMQSHPASERGNPLIDMQTMSPTPKLDDPGIGLRENGRTVLTYGAMR
SLFDDPDGREPSRTVELHLTGHMEKFAWSFDGLKFMDAEPLRLNYGERMRIVLVNDTMMT
HPIHLHGMWSDVEDETGEFHLRKHTVDMPPGTKRSYRVRADALGRWAYHCHLLYHMEAGM
MREVRVEERA