Protein Info for ABIE51_RS09550 in Lysobacter sp. OAE881

Annotation: Cu(I)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 19 to 143 (125 residues), 161 bits, see alignment E=7e-52 PF00376: MerR" amino acids 19 to 56 (38 residues), 54.5 bits, see alignment 1.2e-18 PF13411: MerR_1" amino acids 19 to 84 (66 residues), 57.4 bits, see alignment E=1.9e-19 PF09278: MerR-DNA-bind" amino acids 61 to 125 (65 residues), 76.2 bits, see alignment E=3.7e-25

Best Hits

KEGG orthology group: None (inferred from 62% identity to mpo:Mpop_2538)

Predicted SEED Role

"Cu(I)-responsive transcriptional regulator" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>ABIE51_RS09550 Cu(I)-responsive transcriptional regulator (Lysobacter sp. OAE881)
MPRMPRPELADARQQGLHNIGEAARHSGVSAKMIWHYESIGLIPPPNRTFAGYRLYNDAD
LHRLGFIRRARGLGFSIKQIEALLGLWDDRSRASAEVKRLAESHVDELATKIAEMQAMQR
TLQDLARRCHGDDRPDCPILEDLAKTTDARDAHLPSRHEPDDAPLSFEAGNQLRRVGGR